PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400006325
Common NameLOC102603672
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 340aa    MW: 36693 Da    PI: 6.7679
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400006325genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.11.2e-18260294135
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                           Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  PGSC0003DMP400006325 260 CSHCGVQKTPQWRAGPMGAKTLCNACGVRFKSGRL 294
                           *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169929.6E-7918338IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.78254290IPR000679Zinc finger, GATA-type
SMARTSM004013.7E-16254308IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.71E-14256317No hitNo description
Gene3DG3DSA:3.30.50.106.0E-15258292IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.03E-13259307No hitNo description
PROSITE patternPS003440260285IPR000679Zinc finger, GATA-type
PfamPF003201.5E-16260294IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MDCVKGALRN SFVPETPLKM TQNQTFGDDL SAAGAGQNGV SGDDFFVDDL LDFSNGFVEG  60
EGEEEEGKNQ GGEDISVQKP CSVSISVSPL KKTEIDDKDK VTISVKEDFS SLPVSEISVP  120
TDDLDSLEWL SHFVEDSFSG YSLAYPAGKL EVEKKTGDGE IPVEEKKPCF ATPVQTKART  180
KRGRTSVRFW PACSGSLTDS SSSSTSSSST TTMSSSPTAS WFLYPTPVHS AESPGKPLAK  240
KLKKKPAPHG GNGPQQPRRC SHCGVQKTPQ WRAGPMGAKT LCNACGVRFK SGRLLPEYRP  300
ACSPTFSTEL HSNNHRKVLE MRRKKESEET GLAQPVQSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2153580.0AC215358.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0023N04, complete sequence.
GenBankAC2154920.0AC215492.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02SLm0128E12, complete sequence.
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006340696.10.0PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH578e-74GATA5_ARATH; GATA transcription factor 5
TrEMBLM0ZVM00.0M0ZVM0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000091180.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11542481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-67GATA transcription factor 5
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]